(data stored in ACNUC7421 zone)

EMBL: CP001791.PE422

CP001791.PE422       Location/Qualifiers
FT   CDS             462719..464719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0436"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="KEGG: pcr:Pcryo_0743 TRAP transporter, 4TM/12TM
FT                   fusion protein; TIGRFAM: TRAP transporter, 4TM/12TM fusion
FT                   protein; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97974"
FT                   /db_xref="GOA:D6XXB7"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB7"
FT                   /inference="protein motif:TFAM:TIGR02123"
FT                   /protein_id="ADH97974.1"
FT                   /translation="MSKEAVPNEQTKEVLEKYDNESRVRSYRKYYVGLIVSIIAISLSV
FT                   YHLYTSYFGTPVTLQHRSIHVAVVLALIFLIYPAYKKLDRRKLHWYDVILAMMAISTTV
FT                   YIYIDYDGIVRRGGMPNEWDLVFGLILVALVLEGARRVTGWALPLLATLFIAYGLYGNH
FT                   LSGLFRHRGYEWSDIVNFMYVTTEGVYGTAISVSATYIFLFILFGAFLQKSGMGQFFND
FT                   LALAIAGQTKGGPAKVSVIASGFLGSINGAAVANVVTTGSFTIPLMKKIGYKKDFAGAV
FT                   EASASVGGQILPPIMGAAAFIMAEILGIAYRDIALAALLPALLFYLGVIIQIHLRATKE
FT                   GLQGISKENLPLVKNVMMERGHLLIPLLFLMYMLFLSGRTIIFSAFLTILVTVAVSMIR
FT                   KTTRMSVKDIIGALDNGARTALAVAIACASVGIIVGIATLTGFGLKLANGIVILGGESL
FT                   FLTLMFTMVASIVLGMGLPSIPTYIITATMAAPALVQLGIEPLVAHLFVFYFGIFANIT
FT                   PPVALAAFAAAGISGGRQMRTGGISMKLALAGFIVPYIFVYNSNLLLINTTIMQGIVVV
FT                   ITSVIGVTMLSFAAEGYFFTKMNWLFRAVLFGGALLFMNPNGYQDLIAILILVAVGILQ
FT                   YMKAKKEGGINLPLEGYRDRYDQEEPAIVTT"
     MSKEAVPNEQ TKEVLEKYDN ESRVRSYRKY YVGLIVSIIA ISLSVYHLYT SYFGTPVTLQ        60
     HRSIHVAVVL ALIFLIYPAY KKLDRRKLHW YDVILAMMAI STTVYIYIDY DGIVRRGGMP       120
     NEWDLVFGLI LVALVLEGAR RVTGWALPLL ATLFIAYGLY GNHLSGLFRH RGYEWSDIVN       180
     FMYVTTEGVY GTAISVSATY IFLFILFGAF LQKSGMGQFF NDLALAIAGQ TKGGPAKVSV       240
     IASGFLGSIN GAAVANVVTT GSFTIPLMKK IGYKKDFAGA VEASASVGGQ ILPPIMGAAA       300
     FIMAEILGIA YRDIALAALL PALLFYLGVI IQIHLRATKE GLQGISKENL PLVKNVMMER       360
     GHLLIPLLFL MYMLFLSGRT IIFSAFLTIL VTVAVSMIRK TTRMSVKDII GALDNGARTA       420
     LAVAIACASV GIIVGIATLT GFGLKLANGI VILGGESLFL TLMFTMVASI VLGMGLPSIP       480
     TYIITATMAA PALVQLGIEP LVAHLFVFYF GIFANITPPV ALAAFAAAGI SGGRQMRTGG       540
     ISMKLALAGF IVPYIFVYNS NLLLINTTIM QGIVVVITSV IGVTMLSFAA EGYFFTKMNW       600
     LFRAVLFGGA LLFMNPNGYQ DLIAILILVA VGILQYMKAK KEGGINLPLE GYRDRYDQEE       660
     PAIVTT                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page