(data stored in ACNUC7421 zone)

EMBL: CP001791.PE424

CP001791.PE424       Location/Qualifiers
FT   CDS             465830..465979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97976"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97976.1"
FT                   /translation="MKRRERENMIHFLMQVRNTSQERLMVMTDEDIEYLYSREYDEQEA
FT                   YEYL"
     MKRRERENMI HFLMQVRNTS QERLMVMTDE DIEYLYSREY DEQEAYEYL                    49
//

If you have problems or comments...

PBIL Back to PBIL home page