(data stored in ACNUC7421 zone)

EMBL: CP001791.PE425

CP001791.PE425       Location/Qualifiers
FT   CDS             466127..467068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bpt:Bpet3357 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97977"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC0"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH97977.1"
FT                   /translation="MRGMLAVLVLLMMSSCANDDEVVRDSFPEEAVTIIVPYSPGGSSD
FT                   QMARLTAEGLSDYWGIEVIVDNHDGRQSGSGLLAIAEADADGYTLGMFGNPDELVHARL
FT                   YDTELAMTDYDYLMGFDQMPHALLAGPGFEGEDFEDWIDIANRQPGRLTVGHSGSLGEL
FT                   MIFLLENETGVDVTPVRYDGGGELIQALSEDQIDTALSSCEAADDVARSGGRKLGCTGS
FT                   PDGDGTTFSEQGYEILLNVMRVLVAPQGIPADHRDEIISALETVFETEAWQEAVADAEI
FT                   AFVQTGPDDLMELVREMDEKIERRIEEAELSR"
     MRGMLAVLVL LMMSSCANDD EVVRDSFPEE AVTIIVPYSP GGSSDQMARL TAEGLSDYWG        60
     IEVIVDNHDG RQSGSGLLAI AEADADGYTL GMFGNPDELV HARLYDTELA MTDYDYLMGF       120
     DQMPHALLAG PGFEGEDFED WIDIANRQPG RLTVGHSGSL GELMIFLLEN ETGVDVTPVR       180
     YDGGGELIQA LSEDQIDTAL SSCEAADDVA RSGGRKLGCT GSPDGDGTTF SEQGYEILLN       240
     VMRVLVAPQG IPADHRDEII SALETVFETE AWQEAVADAE IAFVQTGPDD LMELVREMDE       300
     KIERRIEEAE LSR                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page