(data stored in ACNUC7421 zone)

EMBL: CP001791.PE426

CP001791.PE426       Location/Qualifiers
FT   CDS             467376..468518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0440"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: hha:Hhal_1932 beta-lactamase domain-containing
FT                   protein; PFAM: beta-lactamase domain protein; SMART:
FT                   Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97978"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADH97978.1"
FT                   /translation="MSLKVMTANELGQKIIAREDLFILDVRNEDAYQDWKIEGDSITSI
FT                   NKPYFDLIDGVDEILGELPKDKEILVACAKEGSSQFVAEQIVEATGQDVYYLEGGMKNY
FT                   SEDLQPVKLGDLSNGGELYQFVRLGKGCLSYIAVAKNGDAAIVDTTRMVDQYQAFLDDK
FT                   KATLKHAIDTHLHADHISGARTMRERTGAKYWLPSKDADEVQFNYEAFEDGQELTIGAA
FT                   GEEIQLKAVYSPGHTIGSTSVIIDDQYLVTGDILFVESIGRPDLAGKAEDWVGDLRNSL
FT                   YVTFKNLDQNLKVLPAHFAKFAEVDEHGRVFETLEELFKTNEGLQFEDEAEFRSYVTGN
FT                   LPPQPNSYQEIRQTNMGKIDPEPEEKTEMEIGPNRCAVTE"
     MSLKVMTANE LGQKIIARED LFILDVRNED AYQDWKIEGD SITSINKPYF DLIDGVDEIL        60
     GELPKDKEIL VACAKEGSSQ FVAEQIVEAT GQDVYYLEGG MKNYSEDLQP VKLGDLSNGG       120
     ELYQFVRLGK GCLSYIAVAK NGDAAIVDTT RMVDQYQAFL DDKKATLKHA IDTHLHADHI       180
     SGARTMRERT GAKYWLPSKD ADEVQFNYEA FEDGQELTIG AAGEEIQLKA VYSPGHTIGS       240
     TSVIIDDQYL VTGDILFVES IGRPDLAGKA EDWVGDLRNS LYVTFKNLDQ NLKVLPAHFA       300
     KFAEVDEHGR VFETLEELFK TNEGLQFEDE AEFRSYVTGN LPPQPNSYQE IRQTNMGKID       360
     PEPEEKTEME IGPNRCAVTE                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page