(data stored in ACNUC7421 zone)

EMBL: CP001791.PE427

CP001791.PE427       Location/Qualifiers
FT   CDS             468626..470296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0441"
FT                   /product="sulfate transporter"
FT                   /note="KEGG: gsu:GSU2312 sulfate transporter family
FT                   protein; TIGRFAM: sulfate transporter; PFAM: sulphate
FT                   transporter; Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97979"
FT                   /db_xref="GOA:D6XXC2"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC2"
FT                   /inference="protein motif:TFAM:TIGR00815"
FT                   /protein_id="ADH97979.1"
FT                   /translation="MQQWFPLWQQLQHYDLKSDLKGDLNAALIVAIMLIPQGMAYAMLA
FT                   GLPPVMGLYASTVPLFIYALMGTSRQLAVGPVAMVSLLIFTGVSGLAEPGSAEYISYVI
FT                   LLALMTGVIQLLLGVLKLGVITKFISHAVISGFTSAAAIVIGFSQLNHLLGMDLGDSKN
FT                   VFVIAGTVVARFTEIDPLTLSLGVGGMLILIVAKKKIPKIPAPLFVVVLAIGLVQVFNL
FT                   HDQGVRIVGDIPGGLPGITVPDVSVDTMLILIPTALTIAIIGFVESYAMAKVISTKEKY
FT                   PISADAELRALGAANVGAGFFSGFPVTGGFSRSAVNYESGARTGMASVFTGLFIVLTLL
FT                   FFTSWFYYLPRAILAAIILVAVYGLIDFKEAKHLFQVKKVDGITLIVTFMATLVIGIEM
FT                   GILIGILFSLGVFIYRSAKPHMAELGYVKGMDDYLNIERFPEAETFDDVLMIRIDAPIY
FT                   FANMAYIEEHLRERMIEHSHLKHVVIDFSGVNDMDAVALDEFDEWLDYHRSEGVHFYFV
FT                   LVRGPVRDLFARYGWTDAHHDEFCYHSVQEALTDLKKIG"
     MQQWFPLWQQ LQHYDLKSDL KGDLNAALIV AIMLIPQGMA YAMLAGLPPV MGLYASTVPL        60
     FIYALMGTSR QLAVGPVAMV SLLIFTGVSG LAEPGSAEYI SYVILLALMT GVIQLLLGVL       120
     KLGVITKFIS HAVISGFTSA AAIVIGFSQL NHLLGMDLGD SKNVFVIAGT VVARFTEIDP       180
     LTLSLGVGGM LILIVAKKKI PKIPAPLFVV VLAIGLVQVF NLHDQGVRIV GDIPGGLPGI       240
     TVPDVSVDTM LILIPTALTI AIIGFVESYA MAKVISTKEK YPISADAELR ALGAANVGAG       300
     FFSGFPVTGG FSRSAVNYES GARTGMASVF TGLFIVLTLL FFTSWFYYLP RAILAAIILV       360
     AVYGLIDFKE AKHLFQVKKV DGITLIVTFM ATLVIGIEMG ILIGILFSLG VFIYRSAKPH       420
     MAELGYVKGM DDYLNIERFP EAETFDDVLM IRIDAPIYFA NMAYIEEHLR ERMIEHSHLK       480
     HVVIDFSGVN DMDAVALDEF DEWLDYHRSE GVHFYFVLVR GPVRDLFARY GWTDAHHDEF       540
     CYHSVQEALT DLKKIG                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page