(data stored in ACNUC7421 zone)

EMBL: CP001791.PE43

CP001791.PE43        Location/Qualifiers
FT   CDS             53672..54457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0044"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: pca:Pcar_1695 Mg-dependent DNase; TIGRFAM:
FT                   hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97595"
FT                   /db_xref="GOA:D6XV37"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV37"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADH97595.1"
FT                   /translation="MLFDTHVHLNADHFEDDLEEVLARAKEAGVDEMVVVGFDDKTIRI
FT                   AMDLIERYSFLYAAIGWHPVDAIDLTGEKLRWIEELSSHPKVVAIGETGLDYHWDKSPK
FT                   DVQKEAFRKQIALAKKVKLPIIIHDRDAHQDIVDILREENAADIGGIMHCFGGSVEIAR
FT                   QCLDMNFYISLGGPVTFKNAKRPKEVAKAVPADRLLVETDAPFLAPHPYRGKRNEPAYV
FT                   KLVAEQIAELREQSFEEIALQTTENARTLFGLSSKKEAD"
     MLFDTHVHLN ADHFEDDLEE VLARAKEAGV DEMVVVGFDD KTIRIAMDLI ERYSFLYAAI        60
     GWHPVDAIDL TGEKLRWIEE LSSHPKVVAI GETGLDYHWD KSPKDVQKEA FRKQIALAKK       120
     VKLPIIIHDR DAHQDIVDIL REENAADIGG IMHCFGGSVE IARQCLDMNF YISLGGPVTF       180
     KNAKRPKEVA KAVPADRLLV ETDAPFLAPH PYRGKRNEPA YVKLVAEQIA ELREQSFEEI       240
     ALQTTENART LFGLSSKKEA D                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page