(data stored in ACNUC7421 zone)

EMBL: CP001791.PE430

CP001791.PE430       Location/Qualifiers
FT   CDS             complement(472941..473675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0444"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pat:Patl_2981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97982"
FT                   /db_xref="GOA:D6XXC5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC5"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADH97982.1"
FT                   /translation="MDLELIQWLVIVATGVMIGLAKTGIPALGILVVTLMATVFPARES
FT                   IGIVLPILIVGDIVAVTYYRRSVDWPILTRLIPWVSGGLILGFILLFTVTESRPIEIGI
FT                   GLIVIGMILLQSFKGLQRNTQGTKPLWFVIGMGTLGGFTTMIGNAAGPVMTLFFLSYGL
FT                   SKLQFVGTGAWFFLTVNLIKVPLFMYLGLITLHTLTINALMIPMILAGTWLGIRLLPWI
FT                   PQALFNRIVLILSFIGAVMLLV"
     MDLELIQWLV IVATGVMIGL AKTGIPALGI LVVTLMATVF PARESIGIVL PILIVGDIVA        60
     VTYYRRSVDW PILTRLIPWV SGGLILGFIL LFTVTESRPI EIGIGLIVIG MILLQSFKGL       120
     QRNTQGTKPL WFVIGMGTLG GFTTMIGNAA GPVMTLFFLS YGLSKLQFVG TGAWFFLTVN       180
     LIKVPLFMYL GLITLHTLTI NALMIPMILA GTWLGIRLLP WIPQALFNRI VLILSFIGAV       240
     MLLV                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page