(data stored in ACNUC7421 zone)

EMBL: CP001791.PE431

CP001791.PE431       Location/Qualifiers
FT   CDS             473809..474984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0445"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ypg:YpAngola_A2760 aminotransferase, classes I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97983"
FT                   /db_xref="GOA:D6XXC6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADH97983.1"
FT                   /translation="MRFDEQIARDRTYSVKWDRTEAVFQTKEEILPMWVADMDFKPPEG
FT                   VLGVMNERLQHGIFGYTFVDDEVTDTVRNWMKTRHGWDVDRAWISYSTGVVPSLAKTVQ
FT                   AFTEPGERVLIQSPVYPPFFSMVTENGREVENCQLVETDGEYRIDFTAFEEAAAKPDVK
FT                   LFFLCSPHNPVGRVWTKEELTALADICLAHGVVIVADEIHSDLIMAGQTHVPIASLSED
FT                   ISHQTVTLSAPSKTFNLAGLQASFVIAENEEYRKKLAGVDRSQGNFTLNTFGILAMKTA
FT                   YETGGEWLSELNAYIEENARTVQTFLEKEVPEIRMVTPEATYLLWLDCREVGLDDKALE
FT                   KLFVEDGKIGFNWGHTFGAGGEGFVRMNVACPRKTVEEGLERMKAAIKKHG"
     MRFDEQIARD RTYSVKWDRT EAVFQTKEEI LPMWVADMDF KPPEGVLGVM NERLQHGIFG        60
     YTFVDDEVTD TVRNWMKTRH GWDVDRAWIS YSTGVVPSLA KTVQAFTEPG ERVLIQSPVY       120
     PPFFSMVTEN GREVENCQLV ETDGEYRIDF TAFEEAAAKP DVKLFFLCSP HNPVGRVWTK       180
     EELTALADIC LAHGVVIVAD EIHSDLIMAG QTHVPIASLS EDISHQTVTL SAPSKTFNLA       240
     GLQASFVIAE NEEYRKKLAG VDRSQGNFTL NTFGILAMKT AYETGGEWLS ELNAYIEENA       300
     RTVQTFLEKE VPEIRMVTPE ATYLLWLDCR EVGLDDKALE KLFVEDGKIG FNWGHTFGAG       360
     GEGFVRMNVA CPRKTVEEGL ERMKAAIKKH G                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page