(data stored in ACNUC7421 zone)

EMBL: CP001791.PE434

CP001791.PE434       Location/Qualifiers
FT   CDS             477088..478470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0448"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97986"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH97986.1"
FT                   /translation="MKKQRMVQAAMAGTLVVLAACGNENVDEAGAENQSQNENDVNNAA
FT                   EEMNEADQEPVTIKWYNWDNDVMAQTSEQYIADFEEEYPHITVESISMVPGDSLGTLQN
FT                   LDILLSSGEKVDVISFPNVDSLYQRAEMGALAPLDEFYDNEGITPNDEYFINPMVNDDY
FT                   YGIQYNATLNFMMLNKDAFDEAGLDIPDASWTWADFEEYAGQLVNKEGDNQRYGAYFHT
FT                   WPLYMNPPAQTLMKHPFLYEDGTTNFADESFPEMFAMRERLETEGITKTYAESLGADLG
FT                   YRTEYFNENASMLLTGSWMIGEAGDTDLNPHDFTTAFAPVPVLNEGDPSEYYMGGNFFG
FT                   IGNTSEYKDEAYLFARHVSTNLSDSRSELPGWKKGDPQPVVERMIDGNEDQIDVDSLMY
FT                   TLFGDDISYLDASQISITYAGELDSILVDGFGMYMLDNEPLDEVQAWMVEEATKVIDSY
FT                   NE"
     MKKQRMVQAA MAGTLVVLAA CGNENVDEAG AENQSQNEND VNNAAEEMNE ADQEPVTIKW        60
     YNWDNDVMAQ TSEQYIADFE EEYPHITVES ISMVPGDSLG TLQNLDILLS SGEKVDVISF       120
     PNVDSLYQRA EMGALAPLDE FYDNEGITPN DEYFINPMVN DDYYGIQYNA TLNFMMLNKD       180
     AFDEAGLDIP DASWTWADFE EYAGQLVNKE GDNQRYGAYF HTWPLYMNPP AQTLMKHPFL       240
     YEDGTTNFAD ESFPEMFAMR ERLETEGITK TYAESLGADL GYRTEYFNEN ASMLLTGSWM       300
     IGEAGDTDLN PHDFTTAFAP VPVLNEGDPS EYYMGGNFFG IGNTSEYKDE AYLFARHVST       360
     NLSDSRSELP GWKKGDPQPV VERMIDGNED QIDVDSLMYT LFGDDISYLD ASQISITYAG       420
     ELDSILVDGF GMYMLDNEPL DEVQAWMVEE ATKVIDSYNE                             460
//

If you have problems or comments...

PBIL Back to PBIL home page