(data stored in ACNUC7421 zone)

EMBL: CP001791.PE435

CP001791.PE435       Location/Qualifiers
FT   CDS             478584..480290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0449"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: hypothetical protein; PFAM: histidine kinase
FT                   internal region; ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97987"
FT                   /db_xref="GOA:D6XXD0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD0"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADH97987.1"
FT                   /translation="MNRLRRQIFSKSYSRRIQFMFALFILLPTITLSIITYQSDKQNIA
FT                   EKMDFYNETIIDVIANDIDKLTNDLIFSSHFLIQDKGFKSAIAEISDRDGIQSLTAFQQ
FT                   FEYIRERFLSMETRTLNQNISMFYLNDAGLIVTSRSMPLSQEDIQRQWLSVSENLNLQT
FT                   EMIIQYLGKSYDGSQHYFTRVIPRDLSTGNQGLLTIIVSDDYFQQLFEPVSSGAIRLND
FT                   DKGNMIAGSEIDTAARDSLLERTVSPFGWSLYYETPSQQINEELNQSFYSSLMIIFFLF
FT                   VVFIMLSMKSARQLSRPVEELKLVADQFSQGNRGARFQVTGEDEIQSLGVSVNHMLDEI
FT                   NDLIERIEKKETQKRELELHALYEQIRPHFLMNTLNSIRCSLEMEDDEFHSKKLYSLTM
FT                   LLRKYLKINEPSTLRNEVELLTHYIDIMEMRKGRSYWLKAWLSEETHEVEIPFLTLQPI
FT                   IENAILHAFEDPEHHPIMEIRAEIKDEWFHVTVWDNGSGISQSKVDQLNRSLKDTRLEY
FT                   SKQQGDSLGLVNIAERLKLTFSERATLVINSERGKGTTVQILIPVSDMKGE"
     MNRLRRQIFS KSYSRRIQFM FALFILLPTI TLSIITYQSD KQNIAEKMDF YNETIIDVIA        60
     NDIDKLTNDL IFSSHFLIQD KGFKSAIAEI SDRDGIQSLT AFQQFEYIRE RFLSMETRTL       120
     NQNISMFYLN DAGLIVTSRS MPLSQEDIQR QWLSVSENLN LQTEMIIQYL GKSYDGSQHY       180
     FTRVIPRDLS TGNQGLLTII VSDDYFQQLF EPVSSGAIRL NDDKGNMIAG SEIDTAARDS       240
     LLERTVSPFG WSLYYETPSQ QINEELNQSF YSSLMIIFFL FVVFIMLSMK SARQLSRPVE       300
     ELKLVADQFS QGNRGARFQV TGEDEIQSLG VSVNHMLDEI NDLIERIEKK ETQKRELELH       360
     ALYEQIRPHF LMNTLNSIRC SLEMEDDEFH SKKLYSLTML LRKYLKINEP STLRNEVELL       420
     THYIDIMEMR KGRSYWLKAW LSEETHEVEI PFLTLQPIIE NAILHAFEDP EHHPIMEIRA       480
     EIKDEWFHVT VWDNGSGISQ SKVDQLNRSL KDTRLEYSKQ QGDSLGLVNI AERLKLTFSE       540
     RATLVINSER GKGTTVQILI PVSDMKGE                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page