(data stored in ACNUC7421 zone)

EMBL: CP001791.PE44

CP001791.PE44        Location/Qualifiers
FT   CDS             54665..55879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0045"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; protein of unknown function
FT                   DUF348; G5 domain protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97596"
FT                   /db_xref="GOA:D6XV38"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV38"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADH97596.1"
FT                   /translation="MVQKIKQASERFSARTFAVSVVGVLMLSGIIALVLMEVTKAEVAV
FT                   DMNGEEAVVYTHAENVGDVLNEQGIEIGEHDLVEPSVDTKIEANMTIAYTEAQEVRVSI
FT                   GEDTETVWTTADTVGDLLDDMNQEVGEHDQVEPDLNERLESGMDIAYQEAFPVTVTSDG
FT                   ETEEVWTVSTTVGDLLDAQAIELGELDRVEPEADEELNIEEDVRVVRVEKVTDVVEETI
FT                   SYGTVTENDSSMARGTEEVLEPGEEGKKEKRYEVVLEDGEEVSRELIDEEVVSESQDRV
FT                   VAVGTRSTQQNVSRSGNASSSSSSSSAGEWMNFTATAYTAYCTGCSGVTRTGIDLRANP
FT                   NSRVIAVDPSVIPLGSRVEVEGRGTFLAADTGGAINGRKIDIFMPDRSAALAFGRQSVR
FT                   VRIVE"
     MVQKIKQASE RFSARTFAVS VVGVLMLSGI IALVLMEVTK AEVAVDMNGE EAVVYTHAEN        60
     VGDVLNEQGI EIGEHDLVEP SVDTKIEANM TIAYTEAQEV RVSIGEDTET VWTTADTVGD       120
     LLDDMNQEVG EHDQVEPDLN ERLESGMDIA YQEAFPVTVT SDGETEEVWT VSTTVGDLLD       180
     AQAIELGELD RVEPEADEEL NIEEDVRVVR VEKVTDVVEE TISYGTVTEN DSSMARGTEE       240
     VLEPGEEGKK EKRYEVVLED GEEVSRELID EEVVSESQDR VVAVGTRSTQ QNVSRSGNAS       300
     SSSSSSSAGE WMNFTATAYT AYCTGCSGVT RTGIDLRANP NSRVIAVDPS VIPLGSRVEV       360
     EGRGTFLAAD TGGAINGRKI DIFMPDRSAA LAFGRQSVRV RIVE                        404
//

If you have problems or comments...

PBIL Back to PBIL home page