(data stored in ACNUC7421 zone)

EMBL: CP001791.PE440

CP001791.PE440       Location/Qualifiers
FT   CDS             483804..485270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0454"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   sat:SYN_02676 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97992"
FT                   /db_xref="GOA:D6XXD5"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD5"
FT                   /inference="protein motif:PFAM:PF07940"
FT                   /protein_id="ADH97992.1"
FT                   /translation="MEPCSDVVTLPLPIDWTYCHNDDLEWTYMLNRMKFMEDLAFASLY
FT                   KGDNRYRDSFEFYLEDWMRQHGDGETAVVWRKIDCALRIVHLIRAKAFLCACQSWNNRC
FT                   ESLFSRLAGQTSEYLLRSFTSVDAQSNWGFIETNALIQLAIMQTGKAGFAETVKEAMRR
FT                   LELMVTLQIGGDGVHLEQSPGYHHEVLRNLFECVHLSELNGICVPADVKEGLKKMFKAS
FT                   SRMIRPDGSQPQFGDSDILDIRPFMALAAYRYHDESFVPPLLGTVTFDTLWYTAGDLFC
FT                   HQERYIKDSNDPLRDWLEDSGLQIARSGWERHSDYVCMNAGEMGLSAHGHDDLTHFEWL
FT                   VDGVPFVISTGRGTYRESSLRKQLKTAKGHNMVLIDDKMPSTYGDTWSWLQEAAPVNAK
FT                   MTSAKGYTYMRAAHDGYLSLQSGGLITRELILTPRGSLVVIDSILGGGSHHYQQAFHVS
FT                   ERFTVWKPNKQTLRFNYASLSIKMQQCTPG"
     MEPCSDVVTL PLPIDWTYCH NDDLEWTYML NRMKFMEDLA FASLYKGDNR YRDSFEFYLE        60
     DWMRQHGDGE TAVVWRKIDC ALRIVHLIRA KAFLCACQSW NNRCESLFSR LAGQTSEYLL       120
     RSFTSVDAQS NWGFIETNAL IQLAIMQTGK AGFAETVKEA MRRLELMVTL QIGGDGVHLE       180
     QSPGYHHEVL RNLFECVHLS ELNGICVPAD VKEGLKKMFK ASSRMIRPDG SQPQFGDSDI       240
     LDIRPFMALA AYRYHDESFV PPLLGTVTFD TLWYTAGDLF CHQERYIKDS NDPLRDWLED       300
     SGLQIARSGW ERHSDYVCMN AGEMGLSAHG HDDLTHFEWL VDGVPFVIST GRGTYRESSL       360
     RKQLKTAKGH NMVLIDDKMP STYGDTWSWL QEAAPVNAKM TSAKGYTYMR AAHDGYLSLQ       420
     SGGLITRELI LTPRGSLVVI DSILGGGSHH YQQAFHVSER FTVWKPNKQT LRFNYASLSI       480
     KMQQCTPG                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page