(data stored in ACNUC7421 zone)

EMBL: CP001791.PE444

CP001791.PE444       Location/Qualifiers
FT   CDS             488704..489678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0458"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: pol:Bpro_1737 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97996"
FT                   /db_xref="GOA:D6XXD9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD9"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADH97996.1"
FT                   /translation="MADKPYDIVTLGESMVLLQPLTERIGPSAHFVPSVGGAESNVAAA
FT                   LARLDLRVRWISRLGNDPFAKIIMSALAGEGVDLSCVEKINGERTAVYFKEDSLFEDPR
FT                   VYYYRKESAASKWRKEHVRDVWFEDVKHLHITGITLALGEGTREFVVSAMKKASERGLT
FT                   VSFDPNVRTTLKDPVFWKEAIEDVLPYVDVFMPGRSEAVLLFGNQSDEALIQAGLDHGA
FT                   TIVTMKLGEEGSLTGSKSMLHREKGYPIRTTVDTVGAGDAYAAGFLSVMTAHKINVDDW
FT                   IPNAAKRANVMGAIATTYKGDWEGSPLLHELNDLLEGRVMELR"
     MADKPYDIVT LGESMVLLQP LTERIGPSAH FVPSVGGAES NVAAALARLD LRVRWISRLG        60
     NDPFAKIIMS ALAGEGVDLS CVEKINGERT AVYFKEDSLF EDPRVYYYRK ESAASKWRKE       120
     HVRDVWFEDV KHLHITGITL ALGEGTREFV VSAMKKASER GLTVSFDPNV RTTLKDPVFW       180
     KEAIEDVLPY VDVFMPGRSE AVLLFGNQSD EALIQAGLDH GATIVTMKLG EEGSLTGSKS       240
     MLHREKGYPI RTTVDTVGAG DAYAAGFLSV MTAHKINVDD WIPNAAKRAN VMGAIATTYK       300
     GDWEGSPLLH ELNDLLEGRV MELR                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page