(data stored in ACNUC7421 zone)

EMBL: CP001791.PE445

CP001791.PE445       Location/Qualifiers
FT   CDS             complement(489759..490514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0459"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="KEGG: xcv:XCV0153 short chain dehydrogenase;
FT                   TIGRFAM: 2-deoxy-D-gluconate 3-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97997"
FT                   /db_xref="GOA:D6XXE0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE0"
FT                   /inference="protein motif:TFAM:TIGR01832"
FT                   /protein_id="ADH97997.1"
FT                   /translation="MQRLFSLEGKTAVVTGSARGLGQGMAVGLAEAGADIIGISFSEQQ
FT                   ETKKLVENLGRRFFDIEKDLSIQSDIQGIVEEAINKTGSVDILVNNAGTIKRAEAEHFS
FT                   DEDWDSVIDLNLNSVFRLSKGFGQHMIARGSGKIINIASMLSFQGGLRVPSYTASKHAV
FT                   AGITKSLANEWAAKGVQVNAIAPGYFATDNTAQIRSDESRNAFITSRIPKAEWGTPADL
FT                   QGPVVFLASDASNYMTGHIMAVDGGWLSS"
     MQRLFSLEGK TAVVTGSARG LGQGMAVGLA EAGADIIGIS FSEQQETKKL VENLGRRFFD        60
     IEKDLSIQSD IQGIVEEAIN KTGSVDILVN NAGTIKRAEA EHFSDEDWDS VIDLNLNSVF       120
     RLSKGFGQHM IARGSGKIIN IASMLSFQGG LRVPSYTASK HAVAGITKSL ANEWAAKGVQ       180
     VNAIAPGYFA TDNTAQIRSD ESRNAFITSR IPKAEWGTPA DLQGPVVFLA SDASNYMTGH       240
     IMAVDGGWLS S                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page