(data stored in ACNUC7421 zone)

EMBL: CP001791.PE446

CP001791.PE446       Location/Qualifiers
FT   CDS             complement(490525..491355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0460"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="KEGG: rlt:Rleg2_5662
FT                   4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase; PFAM:
FT                   5-keto 4-deoxyuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97998"
FT                   /db_xref="GOA:D6XXE1"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE1"
FT                   /inference="protein motif:PRIAM:5.3.1.17"
FT                   /protein_id="ADH97998.1"
FT                   /translation="MEIRHATNPTDFKLYTTDRLRSDFLMENLFIEGELNLVYSHYDRV
FT                   ITGGVVPKEEEIKLPIIEQMKTEYFLERREMGIVNIGEPALVNVEGETYELNKRDCLYI
FT                   GKGNQHVSFKSKNPDNPSKLYFVSVNAHTPYPVTLMPIKDATPVKLGSNAESNSRTIYK
FT                   YIHSDGIQSCQLMMGMTLLEPNNMWNTMPAHLHDRRMEVYLYFDMDASSRVFHFMGQPH
FT                   ETRHLVVQNEQVVLSPPWSIHSGVGTNNYTFIWAMAGDNYTFTDMDFIPMEDLR"
     MEIRHATNPT DFKLYTTDRL RSDFLMENLF IEGELNLVYS HYDRVITGGV VPKEEEIKLP        60
     IIEQMKTEYF LERREMGIVN IGEPALVNVE GETYELNKRD CLYIGKGNQH VSFKSKNPDN       120
     PSKLYFVSVN AHTPYPVTLM PIKDATPVKL GSNAESNSRT IYKYIHSDGI QSCQLMMGMT       180
     LLEPNNMWNT MPAHLHDRRM EVYLYFDMDA SSRVFHFMGQ PHETRHLVVQ NEQVVLSPPW       240
     SIHSGVGTNN YTFIWAMAGD NYTFTDMDFI PMEDLR                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page