(data stored in ACNUC7421 zone)

EMBL: CP001791.PE447

CP001791.PE447       Location/Qualifiers
FT   CDS             complement(491579..492229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0461"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="KEGG: dvl:Dvul_0099 hemolysin III family channel
FT                   protein; TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97999"
FT                   /db_xref="GOA:D6XXE2"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE2"
FT                   /inference="protein motif:TFAM:TIGR01065"
FT                   /protein_id="ADH97999.1"
FT                   /translation="MHTFIREPVNSLTHWAGAVLSLIGLVAMLFRSSEAGFGTLEIAAV
FT                   TVFGLSLILLYTASATYHMIIASDSVIAFFRRLDHSMIYILIAGTYTPFCLIAMQGPAG
FT                   WALFGIVTAMAIAGVTFKLIWFHSPRWLSTGIYIGMGWLIVFFVVPLTSVIDPTGLVLL
FT                   VAGGVLYTIGGVLYAIKPDWSILNSIGFHEVFHLFILFGSLAHYFSVYFFVIG"
     MHTFIREPVN SLTHWAGAVL SLIGLVAMLF RSSEAGFGTL EIAAVTVFGL SLILLYTASA        60
     TYHMIIASDS VIAFFRRLDH SMIYILIAGT YTPFCLIAMQ GPAGWALFGI VTAMAIAGVT       120
     FKLIWFHSPR WLSTGIYIGM GWLIVFFVVP LTSVIDPTGL VLLVAGGVLY TIGGVLYAIK       180
     PDWSILNSIG FHEVFHLFIL FGSLAHYFSV YFFVIG                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page