(data stored in ACNUC7421 zone)

EMBL: CP001791.PE448

CP001791.PE448       Location/Qualifiers
FT   CDS             492353..492913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0462"
FT                   /product="Domain of unknown function DUF1836"
FT                   /note="PFAM: Domain of unknown function DUF1836; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98000"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE3"
FT                   /inference="protein motif:PFAM:PF08876"
FT                   /protein_id="ADH98000.1"
FT                   /translation="MTKEPSDSLGRMIRTEDIPTIDLYMDQIIQLFEQTFADTKRDKSD
FT                   KIMTKTMINNYAKGGLLFPIQKKRYSREHIMLIALIYELKGILSVHDIKTALRRISREG
FT                   SPKEMNDVYSRYLKLADENLQLFKDEISKHKKRVESHILEMETDEEVQDVLMILACVNM
FT                   SNLYRRMAEELIDDLADPDEDSL"
     MTKEPSDSLG RMIRTEDIPT IDLYMDQIIQ LFEQTFADTK RDKSDKIMTK TMINNYAKGG        60
     LLFPIQKKRY SREHIMLIAL IYELKGILSV HDIKTALRRI SREGSPKEMN DVYSRYLKLA       120
     DENLQLFKDE ISKHKKRVES HILEMETDEE VQDVLMILAC VNMSNLYRRM AEELIDDLAD       180
     PDEDSL                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page