(data stored in ACNUC7421 zone)

EMBL: CP001791.PE45

CP001791.PE45        Location/Qualifiers
FT   CDS             56059..56649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0046"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; KEGG:
FT                   predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97597"
FT                   /db_xref="GOA:D6XV39"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV39"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ADH97597.1"
FT                   /translation="MERERIGPMIVVEGKNDSLTLKRWFDCDTIETNGSAVPDAVLERI
FT                   ALALGRRGVIVFTDPDYPGDQIRKIIDREVPGCSHAFLPKADAIDVRKGKVGIEHAGYR
FT                   ALQEALASVRRPGDDAQEDPSFETVPLRRLTEAGLLDGPDARSRRRILGELLGIGYNNS
FT                   KQLPKRLHQFRISLREFEEAQAAMIKEMEQFER"
     MERERIGPMI VVEGKNDSLT LKRWFDCDTI ETNGSAVPDA VLERIALALG RRGVIVFTDP        60
     DYPGDQIRKI IDREVPGCSH AFLPKADAID VRKGKVGIEH AGYRALQEAL ASVRRPGDDA       120
     QEDPSFETVP LRRLTEAGLL DGPDARSRRR ILGELLGIGY NNSKQLPKRL HQFRISLREF       180
     EEAQAAMIKE MEQFER                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page