(data stored in ACNUC7421 zone)

EMBL: CP001791.PE450

CP001791.PE450       Location/Qualifiers
FT   CDS             complement(493432..494040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0464"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   ppd:Ppro_2916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98002"
FT                   /db_xref="GOA:D6XXE5"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE5"
FT                   /inference="protein motif:PFAM:PF03458"
FT                   /protein_id="ADH98002.1"
FT                   /translation="MWEILNIIGTIAFALSGVLVALEERYDLMGVYILGFITAFGGGAI
FT                   RNLLIGIPVTELWNQGALFTLAFLVMTLAFFFPNILNWTLQKRGVFFDAIGLGTFSAQG
FT                   ALFAASMGLPISAAIAAAALTGAGGGMVRDVLAGRKPMFLHKEIYIAWTLIPGLLIGSG
FT                   LVTSDIGAFLIVSAVVLLRLGSVQKQWHLPYQSFQPLTK"
     MWEILNIIGT IAFALSGVLV ALEERYDLMG VYILGFITAF GGGAIRNLLI GIPVTELWNQ        60
     GALFTLAFLV MTLAFFFPNI LNWTLQKRGV FFDAIGLGTF SAQGALFAAS MGLPISAAIA       120
     AAALTGAGGG MVRDVLAGRK PMFLHKEIYI AWTLIPGLLI GSGLVTSDIG AFLIVSAVVL       180
     LRLGSVQKQW HLPYQSFQPL TK                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page