(data stored in ACNUC7421 zone)

EMBL: CP001791.PE451

CP001791.PE451       Location/Qualifiers
FT   CDS             494091..495158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0465"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="KEGG: eba:ebA7223 zinc-containing alcohol
FT                   dehydrogenase; TIGRFAM: quinone oxidoreductase, YhdH/YhfP
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98003"
FT                   /db_xref="GOA:D6XXE6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE6"
FT                   /inference="protein motif:TFAM:TIGR02823"
FT                   /protein_id="ADH98003.1"
FT                   /translation="MNLQGNETGGEKDSVKGEWTMTNETFQAFLAKGDGTGEVVNRTLE
FT                   ELPAGEVTIRVSYSDVNYKDALAMHPKTKVVRDYPTVPGIDLAGTVMASDDKRFKPGDR
FT                   VICTSYTLGVGHDGGYSEVARVPGDWVVPMPDGLTEREAMLMGTAGFTAALSIERMEEV
FT                   GVSPDKGPILVTGATGGVGSMAIAMLKKRGYTVTASTGKLASEDYLRKLGADEVIHRDS
FT                   LIPEQPAPLQKTVWAGVVDATGGAPLAAILPAVKQGGAVALSGMTAGVEFTTTVMPFIL
FT                   RGVSILGVDSGFCPMDLRGKVWTRAAGDLYPENLEHTLEEEVTIGELPRIFNRLLEGQA
FT                   VGRTLVRLGQDKGDA"
     MNLQGNETGG EKDSVKGEWT MTNETFQAFL AKGDGTGEVV NRTLEELPAG EVTIRVSYSD        60
     VNYKDALAMH PKTKVVRDYP TVPGIDLAGT VMASDDKRFK PGDRVICTSY TLGVGHDGGY       120
     SEVARVPGDW VVPMPDGLTE REAMLMGTAG FTAALSIERM EEVGVSPDKG PILVTGATGG       180
     VGSMAIAMLK KRGYTVTAST GKLASEDYLR KLGADEVIHR DSLIPEQPAP LQKTVWAGVV       240
     DATGGAPLAA ILPAVKQGGA VALSGMTAGV EFTTTVMPFI LRGVSILGVD SGFCPMDLRG       300
     KVWTRAAGDL YPENLEHTLE EEVTIGELPR IFNRLLEGQA VGRTLVRLGQ DKGDA            355
//

If you have problems or comments...

PBIL Back to PBIL home page