(data stored in ACNUC7421 zone)

EMBL: CP001791.PE453

CP001791.PE453       Location/Qualifiers
FT   CDS             complement(495626..497056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0467"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; glucose-inhibited
FT                   division protein A; KEGG: gbm:Gbem_0457 pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98005"
FT                   /db_xref="GOA:D6XXE8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE8"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ADH98005.1"
FT                   /translation="MKKYDVIVIGGGSGGLTVAAGAASFGAKTALIEGKALGGDCLNVG
FT                   CVPSKALIAAAKTVHQARQAGAFGLSVTGDVDIKAVMQQVQDAITDIQGHDSKERFENM
FT                   GVDVYDGYASFLERDVIAIEGTGSIRGEKIVISTGSSPVIPPVPGLKEAGPLTNETIFS
FT                   LETLPRRLAVIGAGAIGSEMAQAFARLGSEVTLIDMADTPLFREDGEVRETMTKVLSEE
FT                   LTFIGSAMVKEVTVNEQNEKQLLLEQNGKQVTVKADEILVAAGRRPNTGRLNLSFAGIE
FT                   TESTGAVKVDGSLRTTADGVYAVGDVNGGLQFTHVAGVEGKHVVQQLITGLHTKVSYNA
FT                   IPWVTFTDPEVFHLGQTEEELQEQGTEYRILKQPLNSTDRFVAERASVGFVKLLTDKKG
FT                   RLLGAHAVGHGAGDFMQEAVGVMKRGDAAHTLSTVVHPYPTHVEALKGASDQYWRSRMA
FT                   HGLIPYASEKWMQLKRKR"
     MKKYDVIVIG GGSGGLTVAA GAASFGAKTA LIEGKALGGD CLNVGCVPSK ALIAAAKTVH        60
     QARQAGAFGL SVTGDVDIKA VMQQVQDAIT DIQGHDSKER FENMGVDVYD GYASFLERDV       120
     IAIEGTGSIR GEKIVISTGS SPVIPPVPGL KEAGPLTNET IFSLETLPRR LAVIGAGAIG       180
     SEMAQAFARL GSEVTLIDMA DTPLFREDGE VRETMTKVLS EELTFIGSAM VKEVTVNEQN       240
     EKQLLLEQNG KQVTVKADEI LVAAGRRPNT GRLNLSFAGI ETESTGAVKV DGSLRTTADG       300
     VYAVGDVNGG LQFTHVAGVE GKHVVQQLIT GLHTKVSYNA IPWVTFTDPE VFHLGQTEEE       360
     LQEQGTEYRI LKQPLNSTDR FVAERASVGF VKLLTDKKGR LLGAHAVGHG AGDFMQEAVG       420
     VMKRGDAAHT LSTVVHPYPT HVEALKGASD QYWRSRMAHG LIPYASEKWM QLKRKR           476
//

If you have problems or comments...

PBIL Back to PBIL home page