(data stored in ACNUC7421 zone)

EMBL: CP001791.PE454

CP001791.PE454       Location/Qualifiers
FT   CDS             complement(497053..497715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0468"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   wsu:WS0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98006"
FT                   /db_xref="GOA:D6XXE9"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE9"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADH98006.1"
FT                   /translation="MNRWLTIALVTAVIGGLLWFSRSYLDVSPEEIRNWILGFGTLAPI
FT                   LFITLYALRPIILFPASVMSLAGGLAFGALWGTVIIVIGATLSAAIAYLIGGKLGSRLI
FT                   KVKEGGKTATIQKQMAHNGFVYVLIFRFIPVINFDAISYIAATAGVKFRAFITATFIGI
FT                   IPGTFAYAFLGSSFVTLNPWQIAAAVAIFLVFMIVPILLRKKTVRQNRPGRRRRECA"
     MNRWLTIALV TAVIGGLLWF SRSYLDVSPE EIRNWILGFG TLAPILFITL YALRPIILFP        60
     ASVMSLAGGL AFGALWGTVI IVIGATLSAA IAYLIGGKLG SRLIKVKEGG KTATIQKQMA       120
     HNGFVYVLIF RFIPVINFDA ISYIAATAGV KFRAFITATF IGIIPGTFAY AFLGSSFVTL       180
     NPWQIAAAVA IFLVFMIVPI LLRKKTVRQN RPGRRRRECA                             220
//

If you have problems or comments...

PBIL Back to PBIL home page