(data stored in ACNUC7421 zone)

EMBL: CP001791.PE456

CP001791.PE456       Location/Qualifiers
FT   CDS             complement(498019..498486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98008"
FT                   /db_xref="GOA:D6XXF1"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF1"
FT                   /inference="similar to AA sequence:KEGG:Gura_0093"
FT                   /protein_id="ADH98008.1"
FT                   /translation="MLKQIKHWLFKLSANRTINNRDRTNAFTTPVKPMTNWNVAFLTTA
FT                   GVHLKSQEGFDVDAGDPSVRLIPSDTDPDQLMITHTHYDTEEADKDTGAVFPLEALKKL
FT                   AEEGRIGSVAKTHYGMMGYIPETDRLDQESIPVILKQLKKEHVDVLLLSPG"
     MLKQIKHWLF KLSANRTINN RDRTNAFTTP VKPMTNWNVA FLTTAGVHLK SQEGFDVDAG        60
     DPSVRLIPSD TDPDQLMITH THYDTEEADK DTGAVFPLEA LKKLAEEGRI GSVAKTHYGM       120
     MGYIPETDRL DQESIPVILK QLKKEHVDVL LLSPG                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page