(data stored in ACNUC7421 zone)

EMBL: CP001791.PE457

CP001791.PE457       Location/Qualifiers
FT   CDS             498629..499012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0471"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: cbc:CbuK_0645 transcriptional regulator, GntR
FT                   family; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98009"
FT                   /db_xref="GOA:D6XXF2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF2"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH98009.1"
FT                   /translation="MLSSDDTRPIYKQLAEWLETEILSGQFQEGDKVYSQYQLADLYTI
FT                   NPATAAKGLTILLDEGILYKKRGLGMFVAEGARETILTKRRATTVRQSARSFVKEATYV
FT                   GMTDEEMLALLKEMQKEASRDED"
     MLSSDDTRPI YKQLAEWLET EILSGQFQEG DKVYSQYQLA DLYTINPATA AKGLTILLDE        60
     GILYKKRGLG MFVAEGARET ILTKRRATTV RQSARSFVKE ATYVGMTDEE MLALLKEMQK       120
     EASRDED                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page