(data stored in ACNUC7421 zone)

EMBL: CP001791.PE458

CP001791.PE458       Location/Qualifiers
FT   CDS             499002..499904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0472"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vpa:VPA0033 putative ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98010"
FT                   /db_xref="GOA:D6XXF3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH98010.1"
FT                   /translation="MKIECKQATKRFGRRTEAVKDVSLTLDQPSITGLVGRNGAGKTTL
FT                   LQLMAGYLKPTEGKVLIGGEAPFNHEALAANVSLIDDRMAFPEGLSLGMVMKLAEKMYP
FT                   NWNKVIGDGLFAYFGFDHKARHEDLSKGKKSLFNAVFGLAARTDVTFFDEPTTGMDEET
FT                   RRDFYRALLKDYLEEPRIILVSSHHIGELEDLLESVIVMEEGRIFLHEDMADLDDYAFS
FT                   VTGSNEAVTAAVAGKHVLDEEAVGPNLKRVLLKRDMTTIPEPFTDAGFKVGRVSATEVC
FT                   HALTKSRKGAIDDVYSRQH"
     MKIECKQATK RFGRRTEAVK DVSLTLDQPS ITGLVGRNGA GKTTLLQLMA GYLKPTEGKV        60
     LIGGEAPFNH EALAANVSLI DDRMAFPEGL SLGMVMKLAE KMYPNWNKVI GDGLFAYFGF       120
     DHKARHEDLS KGKKSLFNAV FGLAARTDVT FFDEPTTGMD EETRRDFYRA LLKDYLEEPR       180
     IILVSSHHIG ELEDLLESVI VMEEGRIFLH EDMADLDDYA FSVTGSNEAV TAAVAGKHVL       240
     DEEAVGPNLK RVLLKRDMTT IPEPFTDAGF KVGRVSATEV CHALTKSRKG AIDDVYSRQH       300
//

If you have problems or comments...

PBIL Back to PBIL home page