(data stored in ACNUC7421 zone)

EMBL: CP001791.PE460

CP001791.PE460       Location/Qualifiers
FT   CDS             500613..501338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98012"
FT                   /db_xref="GOA:D6XXF5"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98012.1"
FT                   /translation="MSLVLFSLLNIGIMVVVFYVLYRVFFSRLQNRSQSLSFRAFGVYL
FT                   ALLLLAVPFVLIVDGDETEPMQEAEPGMLETVREDVMALIEAGDREGLMTDHRTEILTL
FT                   SASEWPGGISATENLNGIHLIRDTDPAYGDDITVTFVYPHSEFNERVVTEELPEVGLEE
FT                   TDDGISLNFSDQELVFSFITPMITVEQFSDGEEGDHPFMSTSFTSSQSQPIVWIQSAEW
FT                   LPVDGYFSETTRIERQEEE"
     MSLVLFSLLN IGIMVVVFYV LYRVFFSRLQ NRSQSLSFRA FGVYLALLLL AVPFVLIVDG        60
     DETEPMQEAE PGMLETVRED VMALIEAGDR EGLMTDHRTE ILTLSASEWP GGISATENLN       120
     GIHLIRDTDP AYGDDITVTF VYPHSEFNER VVTEELPEVG LEETDDGISL NFSDQELVFS       180
     FITPMITVEQ FSDGEEGDHP FMSTSFTSSQ SQPIVWIQSA EWLPVDGYFS ETTRIERQEE       240
     E                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page