(data stored in ACNUC7421 zone)

EMBL: CP001791.PE461

CP001791.PE461       Location/Qualifiers
FT   CDS             501335..501685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98013"
FT                   /db_xref="GOA:D6XXF6"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98013.1"
FT                   /translation="MKDTVLFTVELLRIILILFAALVGYSLLNTFVMDFFGGLDVFEGN
FT                   DFFRTWFFLLQTLGILGLVTVLYRNKLKKSGWMAKYQGPLQARTVWWIVRISLAAIVAS
FT                   YGIFFGLVVFSG"
     MKDTVLFTVE LLRIILILFA ALVGYSLLNT FVMDFFGGLD VFEGNDFFRT WFFLLQTLGI        60
     LGLVTVLYRN KLKKSGWMAK YQGPLQARTV WWIVRISLAA IVASYGIFFG LVVFSG           116
//

If you have problems or comments...

PBIL Back to PBIL home page