(data stored in ACNUC7421 zone)

EMBL: CP001791.PE465

CP001791.PE465       Location/Qualifiers
FT   CDS             504114..504959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0479"
FT                   /product="protein of unknown function DUF191"
FT                   /note="PFAM: protein of unknown function DUF191; KEGG:
FT                   gur:Gura_0686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98017"
FT                   /db_xref="GOA:D6XXG0"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG0"
FT                   /inference="protein motif:PFAM:PF02642"
FT                   /protein_id="ADH98017.1"
FT                   /translation="MQRIAFSPCPNDTFIFHALVKGLIKGAPPLDVTYADIDKTNYWAQ
FT                   DREGPGIMKISYAALPYVVDDYQLIPCGGALGRGVGPLVLTKEPADGISFLKGKTVAVP
FT                   SDRSTAYMLFRLWVAQRLPEGVGKIVILPFQDIMPAVRDGKVDAGLVIHEARFTYPLYG
FT                   LNLLQDLGDWWEQDTGAPIPLGAIIARKGQVDAGQWTDWIRSSVQYAFDHPDASAAYVM
FT                   EHAQEMEKDVQKQHIDLYVNEFSLDLGKDGFHAVDSLLGRAAKEGLVPEIDLKRLRLGE
FT                   "
     MQRIAFSPCP NDTFIFHALV KGLIKGAPPL DVTYADIDKT NYWAQDREGP GIMKISYAAL        60
     PYVVDDYQLI PCGGALGRGV GPLVLTKEPA DGISFLKGKT VAVPSDRSTA YMLFRLWVAQ       120
     RLPEGVGKIV ILPFQDIMPA VRDGKVDAGL VIHEARFTYP LYGLNLLQDL GDWWEQDTGA       180
     PIPLGAIIAR KGQVDAGQWT DWIRSSVQYA FDHPDASAAY VMEHAQEMEK DVQKQHIDLY       240
     VNEFSLDLGK DGFHAVDSLL GRAAKEGLVP EIDLKRLRLG E                           281
//

If you have problems or comments...

PBIL Back to PBIL home page