(data stored in ACNUC7421 zone)

EMBL: CP001791.PE466

CP001791.PE466       Location/Qualifiers
FT   CDS             complement(505054..506451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0480"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rlt:Rleg2_0160 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98018"
FT                   /db_xref="GOA:D6XXG1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADH98018.1"
FT                   /translation="MDTYQKKIIVALLIATFLAAVEVTVISTAMPSITSDLGGMDKISW
FT                   VFAAYLLTYAVMTPIFGKLADLFGRKRVFIGGVSVFLLGSVLCGFSQSMEQLIFFRAIQ
FT                   GIGAGALTPMTFTIVGDVFQYEQRAKAQAIIGSIWGVAGIFGPLVGGFFVDFLTWHWIF
FT                   FINVPFGLVAMHLVGRHLQEQIEKKKRRIDYKGALTFIIGTGALLYALLSGGTDIAWTD
FT                   PLMYSLFLIAGLFLVLFVRIQIRTAEPMVPLHLLKNQHLLTANLASLMLGMILIGLTAY
FT                   LPLWVQGVLGLAAIFSGLTLIPMSLGWPIAAFMSSRLLKQFGAKPVCIGGTGLIMLSTL
FT                   AMTFVTAATPNWLLVIIMFFVGAGFGLAMTMFTVIVQSSVDWTNRGAASSSNAFLRTLG
FT                   QTLGITILGATLNQYIGGYGGEASAPADVLASGLSTVFLLLFIIATVAFLITFRLPSEE
FT                   PEHARSS"
     MDTYQKKIIV ALLIATFLAA VEVTVISTAM PSITSDLGGM DKISWVFAAY LLTYAVMTPI        60
     FGKLADLFGR KRVFIGGVSV FLLGSVLCGF SQSMEQLIFF RAIQGIGAGA LTPMTFTIVG       120
     DVFQYEQRAK AQAIIGSIWG VAGIFGPLVG GFFVDFLTWH WIFFINVPFG LVAMHLVGRH       180
     LQEQIEKKKR RIDYKGALTF IIGTGALLYA LLSGGTDIAW TDPLMYSLFL IAGLFLVLFV       240
     RIQIRTAEPM VPLHLLKNQH LLTANLASLM LGMILIGLTA YLPLWVQGVL GLAAIFSGLT       300
     LIPMSLGWPI AAFMSSRLLK QFGAKPVCIG GTGLIMLSTL AMTFVTAATP NWLLVIIMFF       360
     VGAGFGLAMT MFTVIVQSSV DWTNRGAASS SNAFLRTLGQ TLGITILGAT LNQYIGGYGG       420
     EASAPADVLA SGLSTVFLLL FIIATVAFLI TFRLPSEEPE HARSS                       465
//

If you have problems or comments...

PBIL Back to PBIL home page