(data stored in ACNUC7421 zone)

EMBL: CP001791.PE467

CP001791.PE467       Location/Qualifiers
FT   CDS             complement(506537..507274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0481"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   shn:Shewana3_2409 sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98019"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG2"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ADH98019.1"
FT                   /translation="MRLNNKILPAFVLVLILTAAGCSQVSDNEDTLSEPSENNTVEGNS
FT                   QTGVNDVLADGESETEEPIESAGSETDSKENSQVVQTTEPVQPVSSGPRGIDPSVISIP
FT                   AIDVRADIEDVGILENGQMGVPDDGDTVGWFHRGPKPGAAGNSVMAGHVDDRSGPAIFF
FT                   DLDQLTLGDRIYIEDVEGTELAFEVTRMEVYPYDDAPMDLIFGPSATQRLNLITCTGEF
FT                   DRNAGTHRERLVVFTELVTDQEL"
     MRLNNKILPA FVLVLILTAA GCSQVSDNED TLSEPSENNT VEGNSQTGVN DVLADGESET        60
     EEPIESAGSE TDSKENSQVV QTTEPVQPVS SGPRGIDPSV ISIPAIDVRA DIEDVGILEN       120
     GQMGVPDDGD TVGWFHRGPK PGAAGNSVMA GHVDDRSGPA IFFDLDQLTL GDRIYIEDVE       180
     GTELAFEVTR MEVYPYDDAP MDLIFGPSAT QRLNLITCTG EFDRNAGTHR ERLVVFTELV       240
     TDQEL                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page