(data stored in ACNUC7421 zone)

EMBL: CP001791.PE468

CP001791.PE468       Location/Qualifiers
FT   CDS             complement(507258..508145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98020"
FT                   /db_xref="GOA:D6XXG3"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98020.1"
FT                   /translation="MQLIISICCTKTNLHAKNQIEEMIQLQLKKWLLSSLAMVLMLSLF
FT                   AGTAFADNHGDDNAMVRVFHASPDAPAVDIYVNGDLAVEGAAFEDITGYLELPAGDHDV
FT                   AIHAAGEDEAVYEQTLTVEGGTHYTVAAVDFLDGGDFRLEAFVDDNTVAEGMTKVRVGH
FT                   LSPDAPAVDVGLVGGDSLFEGAEFFAVTDYLELDPDTYDLEIRAAGTEDQVLDLSGTTL
FT                   EADTVYSVYAVGALEDLGVVVVADDAYAMPGDMPQTGMGGASQSSTMLPLYLSLLAGAG
FT                   AMFVIVRRRYAFEQ"
     MQLIISICCT KTNLHAKNQI EEMIQLQLKK WLLSSLAMVL MLSLFAGTAF ADNHGDDNAM        60
     VRVFHASPDA PAVDIYVNGD LAVEGAAFED ITGYLELPAG DHDVAIHAAG EDEAVYEQTL       120
     TVEGGTHYTV AAVDFLDGGD FRLEAFVDDN TVAEGMTKVR VGHLSPDAPA VDVGLVGGDS       180
     LFEGAEFFAV TDYLELDPDT YDLEIRAAGT EDQVLDLSGT TLEADTVYSV YAVGALEDLG       240
     VVVVADDAYA MPGDMPQTGM GGASQSSTML PLYLSLLAGA GAMFVIVRRR YAFEQ            295
//

If you have problems or comments...

PBIL Back to PBIL home page