(data stored in ACNUC7421 zone)

EMBL: CP001791.PE47

CP001791.PE47        Location/Qualifiers
FT   CDS             57755..58000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0048"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97599"
FT                   /db_xref="GOA:D6XV41"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV41"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ADH97599.1"
FT                   /translation="MAKQTLADIKRSIECYVGQEVTICANGGRKKTIERSGMLEGVYPS
FT                   VFTVKLDRDKYPIERLSFSYTDLLTESVTLSLAEKV"
     MAKQTLADIK RSIECYVGQE VTICANGGRK KTIERSGMLE GVYPSVFTVK LDRDKYPIER        60
     LSFSYTDLLT ESVTLSLAEK V                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page