(data stored in ACNUC7421 zone)

EMBL: CP001791.PE470

CP001791.PE470       Location/Qualifiers
FT   CDS             509718..510878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0484"
FT                   /product="Cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /note="KEGG: gsu:GSU0945 cystathionine beta-lyase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98022"
FT                   /db_xref="GOA:D6XXG5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG5"
FT                   /inference="protein motif:PRIAM:4.4.1.1"
FT                   /protein_id="ADH98022.1"
FT                   /translation="MTESLDIQTRLLHHRHKTDPHNGAVSVGVQHASTFHQNSLEQFGA
FT                   YDYARSGNPTREALEEIFAGLENGTDAFAFASGMAAISTTFMLLSSGDHLVITEDVYGG
FT                   TFRMTTEVLTRLGIEHTFVDMTRVDEVKATLQDNTKMIFMETPSNPTMKITPIRDIVAL
FT                   AEAHDCLTVLDNTFMTPVLQRPLDLGVDIVVHSATKFIGGHSDVVSGLAVVKRPDLAGR
FT                   LGFLQNSFGAIPGPDDCWLIMRGLKTLHTRMMVSQEVASNLAHWLDVQPEVKRVYYPGF
FT                   SDQLGNAIHAGQSDGPGAVLSFELADREAVSRFSQAVEIPVFAVSLGAVESILSYPAKM
FT                   SHAAMPDHERVARGITDGLLRLSVGLESEADLKRDFRQAFDSLARM"
     MTESLDIQTR LLHHRHKTDP HNGAVSVGVQ HASTFHQNSL EQFGAYDYAR SGNPTREALE        60
     EIFAGLENGT DAFAFASGMA AISTTFMLLS SGDHLVITED VYGGTFRMTT EVLTRLGIEH       120
     TFVDMTRVDE VKATLQDNTK MIFMETPSNP TMKITPIRDI VALAEAHDCL TVLDNTFMTP       180
     VLQRPLDLGV DIVVHSATKF IGGHSDVVSG LAVVKRPDLA GRLGFLQNSF GAIPGPDDCW       240
     LIMRGLKTLH TRMMVSQEVA SNLAHWLDVQ PEVKRVYYPG FSDQLGNAIH AGQSDGPGAV       300
     LSFELADREA VSRFSQAVEI PVFAVSLGAV ESILSYPAKM SHAAMPDHER VARGITDGLL       360
     RLSVGLESEA DLKRDFRQAF DSLARM                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page