(data stored in ACNUC7421 zone)

EMBL: CP001791.PE472

CP001791.PE472       Location/Qualifiers
FT   CDS             516341..517273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0487"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: sun:SUN_1298 putative manganese-dependent
FT                   inorganic pyrophosphatase; PFAM: DHHA2 domain protein;
FT                   phosphoesterase RecJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98024"
FT                   /db_xref="GOA:D6XXG7"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG7"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADH98024.1"
FT                   /translation="MSEEKVLIFGHRNPDTDTICSALVYADLKTKLGENVEAVRLGEVG
FT                   AETQCALDTFGVTAPRMMEHVSDEASKVILVDHNERQQSAEDIDQVQVTEVIDHHRIAN
FT                   FETDSPLYYRAEPVGCTATILNKMYKEHGVEVSKEMAGLMVSAIISDSLLFKSPTCTDE
FT                   DLAAAKELAPVAGIDLDEYGLEMLKAGANMAEKTPEQLITLDSKEFAMGDVKAVIGQVN
FT                   VVDAGDVLDRQAAVEEAMQKEVESRGLGLYMLAVTDILNSNSIALAVGDKKEAIEQAFD
FT                   VRFENGQATLEGVVSRKKQIVPPLQKLLG"
     MSEEKVLIFG HRNPDTDTIC SALVYADLKT KLGENVEAVR LGEVGAETQC ALDTFGVTAP        60
     RMMEHVSDEA SKVILVDHNE RQQSAEDIDQ VQVTEVIDHH RIANFETDSP LYYRAEPVGC       120
     TATILNKMYK EHGVEVSKEM AGLMVSAIIS DSLLFKSPTC TDEDLAAAKE LAPVAGIDLD       180
     EYGLEMLKAG ANMAEKTPEQ LITLDSKEFA MGDVKAVIGQ VNVVDAGDVL DRQAAVEEAM       240
     QKEVESRGLG LYMLAVTDIL NSNSIALAVG DKKEAIEQAF DVRFENGQAT LEGVVSRKKQ       300
     IVPPLQKLLG                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page