(data stored in ACNUC7421 zone)

EMBL: CP001791.PE474

CP001791.PE474       Location/Qualifiers
FT   CDS             complement(518948..519631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0490"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: ent:Ent638_2505 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98026"
FT                   /db_xref="GOA:D6XXG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG9"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH98026.1"
FT                   /translation="MSQIEWQYIFDPALAWRALPTVLEGLTLTLYISLISMVLGLVMSL
FT                   FLALARQSGHLYLQIPARMYISFMRGVPILIILFMLYFGFPYIGIEFTAVNAAIIGFSF
FT                   NSAAYMAEINRSAIDAVPKGQWEAARSLGLSYTKMMRQVVLPQASRIAVPPLTNVLLDL
FT                   IKASSLAAMITVPEIFQMSRIVAGREMDYMTMFILVAMIYWVICTLMTQLQNYLEKRFA
FT                   RYGEL"
     MSQIEWQYIF DPALAWRALP TVLEGLTLTL YISLISMVLG LVMSLFLALA RQSGHLYLQI        60
     PARMYISFMR GVPILIILFM LYFGFPYIGI EFTAVNAAII GFSFNSAAYM AEINRSAIDA       120
     VPKGQWEAAR SLGLSYTKMM RQVVLPQASR IAVPPLTNVL LDLIKASSLA AMITVPEIFQ       180
     MSRIVAGREM DYMTMFILVA MIYWVICTLM TQLQNYLEKR FARYGEL                     227
//

If you have problems or comments...

PBIL Back to PBIL home page