(data stored in ACNUC7421 zone)

EMBL: CP001791.PE484

CP001791.PE484       Location/Qualifiers
FT   CDS             complement(531511..531936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0500"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: dvm:DvMF_1529 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98036"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH9"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADH98036.1"
FT                   /translation="MFSNIILAADGSEHSLRAAEKAIALGKLSKKPQIELLHVVSGATS
FT                   KTDVLHHGDSDAASRKRRKQLDPIVERIERANIPVTVTTITASNSVPESIIKHVNEQNP
FT                   DVLVLGSRGLSSVQTMVLGSVSHKVMKYVKAPVMMVK"
     MFSNIILAAD GSEHSLRAAE KAIALGKLSK KPQIELLHVV SGATSKTDVL HHGDSDAASR        60
     KRRKQLDPIV ERIERANIPV TVTTITASNS VPESIIKHVN EQNPDVLVLG SRGLSSVQTM       120
     VLGSVSHKVM KYVKAPVMMV K                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page