(data stored in ACNUC7421 zone)

EMBL: CP001791.PE485

CP001791.PE485       Location/Qualifiers
FT   CDS             complement(532019..533482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0501"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS;
FT                   Xanthine/uracil/vitamin C permease; KEGG: avi:Avi_5067
FT                   sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98037"
FT                   /db_xref="GOA:D6XXI0"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI0"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ADH98037.1"
FT                   /translation="MNLIQNFKQTWLFNVRGDILAGIVVALALIPEAIAFSIIAGVDPM
FT                   VGLYASFSIALVIAIVGGRPGMISGATGAMALLMITLVADHGLEYLLAATILTGIIQIL
FT                   FGVFKLSSIMKFVPRSVMIGFVNALAILIFTSQLQHFVGETWIMYALVALTLAIIYILP
FT                   RFTTAVPSTLVAIIVVTAIAIVMNMGVRTVGDMGSLSSTLPIFALPNIPLTFETFMIIL
FT                   PYSLALAIVGILESLLTASIVDDMTDTDSNKNKESRGQGIANVVSGCFGGMAGCAMIGQ
FT                   SVINVKSGGRGRLSSLTSAVTLMFLIIVLGSVVVQIPMAALAGVMIMVSIGTFDWSSLR
FT                   NIHRIPRSDAAVMVVTVGTVVYTHDLSLGVLAGVLLSAVFFAWKVSKVNVHKIYHDKDR
FT                   SVTYHVEGQLFFASVTDFLEKVDFFEDVDTVTFDISNSHLWDDSAIGAFDKIESKFEKR
FT                   DIPVYYTGMNRESTQLYDRITGLSKASGH"
     MNLIQNFKQT WLFNVRGDIL AGIVVALALI PEAIAFSIIA GVDPMVGLYA SFSIALVIAI        60
     VGGRPGMISG ATGAMALLMI TLVADHGLEY LLAATILTGI IQILFGVFKL SSIMKFVPRS       120
     VMIGFVNALA ILIFTSQLQH FVGETWIMYA LVALTLAIIY ILPRFTTAVP STLVAIIVVT       180
     AIAIVMNMGV RTVGDMGSLS STLPIFALPN IPLTFETFMI ILPYSLALAI VGILESLLTA       240
     SIVDDMTDTD SNKNKESRGQ GIANVVSGCF GGMAGCAMIG QSVINVKSGG RGRLSSLTSA       300
     VTLMFLIIVL GSVVVQIPMA ALAGVMIMVS IGTFDWSSLR NIHRIPRSDA AVMVVTVGTV       360
     VYTHDLSLGV LAGVLLSAVF FAWKVSKVNV HKIYHDKDRS VTYHVEGQLF FASVTDFLEK       420
     VDFFEDVDTV TFDISNSHLW DDSAIGAFDK IESKFEKRDI PVYYTGMNRE STQLYDRITG       480
     LSKASGH                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page