(data stored in ACNUC7421 zone)

EMBL: CP001791.PE486

CP001791.PE486       Location/Qualifiers
FT   CDS             533747..534163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98038"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98038.1"
FT                   /translation="MRILMIVLLFVITACAPPTNQEGITLEIDATYTSGTLYLVPMIVH
FT                   EGNEAVSVSLYDAELRIVEVTREDATVYDSSPGSTGDEPVILEQGEVYEGSPVRFTAEA
FT                   GEYEVRAVAEITVTDDELAEDLSLSTEVTVQVQG"
     MRILMIVLLF VITACAPPTN QEGITLEIDA TYTSGTLYLV PMIVHEGNEA VSVSLYDAEL        60
     RIVEVTREDA TVYDSSPGST GDEPVILEQG EVYEGSPVRF TAEAGEYEVR AVAEITVTDD       120
     ELAEDLSLST EVTVQVQG                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page