(data stored in ACNUC7421 zone)

EMBL: CP001791.PE488

CP001791.PE488       Location/Qualifiers
FT   CDS             534716..535711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0504"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: rso:RSp1286 putative DNA-binding sucrose
FT                   operon transcriptional repressor transcription regulator
FT                   protein; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98040"
FT                   /db_xref="GOA:D6XXI3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI3"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADH98040.1"
FT                   /translation="MVTINDIARQAGVSRTTVSRVLNQNGYVSDRAKTKVLEVIEETGY
FT                   VPSEQAKSLRTKKTNVIGVILPRLSSETVSRVVDGMDRELAKAGYQILLSSTSLETEKE
FT                   ADHIRLLESRRVDGIVLFGTHKDEAILNAIKQAKVPVVVLGQDFTPHVSSVVYNDYEAS
FT                   RAAVAALADVGHEKIGFIGVDEADIAVGQERRRGYLDEMKSRGFAVLPEWMQTAGFDMA
FT                   SGSEAFQKMLEYSQTRPTAVFAVTDRLAIGAMQRAKDAGMSVPGEMAFISIGASEASQV
FT                   VTPKLATVDYYNEDAGMSIASLILEEIDEDMKDAKKIVMNYGLLLRDSLC"
     MVTINDIARQ AGVSRTTVSR VLNQNGYVSD RAKTKVLEVI EETGYVPSEQ AKSLRTKKTN        60
     VIGVILPRLS SETVSRVVDG MDRELAKAGY QILLSSTSLE TEKEADHIRL LESRRVDGIV       120
     LFGTHKDEAI LNAIKQAKVP VVVLGQDFTP HVSSVVYNDY EASRAAVAAL ADVGHEKIGF       180
     IGVDEADIAV GQERRRGYLD EMKSRGFAVL PEWMQTAGFD MASGSEAFQK MLEYSQTRPT       240
     AVFAVTDRLA IGAMQRAKDA GMSVPGEMAF ISIGASEASQ VVTPKLATVD YYNEDAGMSI       300
     ASLILEEIDE DMKDAKKIVM NYGLLLRDSL C                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page