(data stored in ACNUC7421 zone)

EMBL: CP001791.PE489

CP001791.PE489       Location/Qualifiers
FT   CDS             535829..537241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0505"
FT                   /product="PTS system, sucrose-specific IIBC subunit"
FT                   /note="KEGG: asa:ASA_2992 PTS system, sucrose-specific IIBC
FT                   component; TIGRFAM: PTS system, sucrose-specific IIBC
FT                   subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system EIIC; Phosphotransferase system
FT                   EIIB/cysteine, phosphorylation site"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98041"
FT                   /db_xref="GOA:D6XXI4"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI4"
FT                   /inference="protein motif:TFAM:TIGR01996"
FT                   /protein_id="ADH98041.1"
FT                   /translation="MSEENKQIAEQLIEAVGGLENIESVAHCATRLRIMVSDKEKIDQE
FT                   KVEELGKVKGAFYNAGQFQVIFGTGTVNKIHEQVVALGAPESSSSDQKKNAAQKGNKVQ
FT                   RLLRTFGDIFVPIIPVLVATGLFMGLRGLLTQEEILAIFGMTPADISDNFLLYTQVLTD
FT                   TAFAFLPALIAWSAFRVFGGSPVIGIVLGLMLVNPALPNAYDVGSGDVDPLYMLGFIPV
FT                   IGYQGSVLPAFIAGFLGAKLEKWLRQRIPEALDLILTPFLTLLIMITAALFVLGPVFTI
FT                   VENGIMAGMSFVLELPLGLSGLIIGGLHQVIVITGVHHIFNLFEIQLLADDGFNPFNAL
FT                   ITAGIAAQGGAALAVAVKTSSKKLKALAFPSSISAFLGITEPAIFGVNLRYIKPFLMGL
FT                   IGGAAGGFFAALFNLQGNGMAVTVIPGMLLYIYDFMPLLLYILTNLIALSVAFILTWMF
FT                   GFNDEMLNEVNG"
     MSEENKQIAE QLIEAVGGLE NIESVAHCAT RLRIMVSDKE KIDQEKVEEL GKVKGAFYNA        60
     GQFQVIFGTG TVNKIHEQVV ALGAPESSSS DQKKNAAQKG NKVQRLLRTF GDIFVPIIPV       120
     LVATGLFMGL RGLLTQEEIL AIFGMTPADI SDNFLLYTQV LTDTAFAFLP ALIAWSAFRV       180
     FGGSPVIGIV LGLMLVNPAL PNAYDVGSGD VDPLYMLGFI PVIGYQGSVL PAFIAGFLGA       240
     KLEKWLRQRI PEALDLILTP FLTLLIMITA ALFVLGPVFT IVENGIMAGM SFVLELPLGL       300
     SGLIIGGLHQ VIVITGVHHI FNLFEIQLLA DDGFNPFNAL ITAGIAAQGG AALAVAVKTS       360
     SKKLKALAFP SSISAFLGIT EPAIFGVNLR YIKPFLMGLI GGAAGGFFAA LFNLQGNGMA       420
     VTVIPGMLLY IYDFMPLLLY ILTNLIALSV AFILTWMFGF NDEMLNEVNG                  470
//

If you have problems or comments...

PBIL Back to PBIL home page