(data stored in ACNUC7421 zone)

EMBL: CP001791.PE49

CP001791.PE49        Location/Qualifiers
FT   CDS             59204..60025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0050"
FT                   /product="purine operon repressor, PurR"
FT                   /note="KEGG: pap:PSPA7_6072 xanthine
FT                   phosphoribosyltransferase; TIGRFAM: pur operon repressor;
FT                   PFAM: purine repressor; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97601"
FT                   /db_xref="GOA:D6XV43"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV43"
FT                   /inference="protein motif:TFAM:TIGR01743"
FT                   /protein_id="ADH97601.1"
FT                   /translation="MKFRRSGRLVDMTQYLLNHPHQQIPLTFFSERYLSAKSSISEDIG
FT                   IVKETFEGKNLGKVETSAGATGGVKFVPVIGNEDAVRQVDQLCEKLEDPARILPGGYLY
FT                   MMDVIGDPKAMQDLGRVIASHYQDAGVDAIMTMATKGIPLAYAVAQLLNVPVSIVRHEQ
FT                   RITEGSIVSINYVSGSKKQIQTMSLARRSLKPASNVLIIDDFMKAGGTIRGMMDLAEEF
FT                   QATVAGAAILTEAVHEEEKLVSDYVSLTRLTEVDVKERKITVKRGSLFDAD"
     MKFRRSGRLV DMTQYLLNHP HQQIPLTFFS ERYLSAKSSI SEDIGIVKET FEGKNLGKVE        60
     TSAGATGGVK FVPVIGNEDA VRQVDQLCEK LEDPARILPG GYLYMMDVIG DPKAMQDLGR       120
     VIASHYQDAG VDAIMTMATK GIPLAYAVAQ LLNVPVSIVR HEQRITEGSI VSINYVSGSK       180
     KQIQTMSLAR RSLKPASNVL IIDDFMKAGG TIRGMMDLAE EFQATVAGAA ILTEAVHEEE       240
     KLVSDYVSLT RLTEVDVKER KITVKRGSLF DAD                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page