(data stored in ACNUC7421 zone)

EMBL: CP001791.PE490

CP001791.PE490       Location/Qualifiers
FT   CDS             537350..537757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0506"
FT                   /product="Camphor resistance CrcB protein"
FT                   /note="PFAM: Camphor resistance CrcB protein; KEGG:
FT                   pmy:Pmen_2385 camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98042"
FT                   /db_xref="GOA:D6XXI5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI5"
FT                   /inference="protein motif:PFAM:PF02537"
FT                   /protein_id="ADH98042.1"
FT                   /translation="MEKQMFYITIAVFVGGAAGTLLRFFINEWSSMALFPLGTVIENIS
FT                   GSLLLGLLTGWAAYRYMNPFFKEGLGAGFCGGFTTMSTLMADVTLLATAGGEAVLMTGL
FT                   YVFVSLAGGLIAAFTGIVLGERFAGKEGDGA"
     MEKQMFYITI AVFVGGAAGT LLRFFINEWS SMALFPLGTV IENISGSLLL GLLTGWAAYR        60
     YMNPFFKEGL GAGFCGGFTT MSTLMADVTL LATAGGEAVL MTGLYVFVSL AGGLIAAFTG       120
     IVLGERFAGK EGDGA                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page