(data stored in ACNUC7421 zone)

EMBL: CP001791.PE491

CP001791.PE491       Location/Qualifiers
FT   CDS             537775..538140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0507"
FT                   /product="CrcB protein"
FT                   /note="KEGG: ftm:FTM_1582 CrcB family protein; TIGRFAM:
FT                   CrcB protein; PFAM: Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98043"
FT                   /db_xref="GOA:D6XXI6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI6"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADH98043.1"
FT                   /translation="MASLGGGLGAVARYHLGRLIKARLDQTWLPNAMLIVNIIGSFGLG
FT                   VTLGGLFGSVTETDPLPNLYFFLATGFMAAFTTFSTFSTEAVGLIRTRKFYPACLYISV
FT                   TLVASFLVFLAGMWLTV"
     MASLGGGLGA VARYHLGRLI KARLDQTWLP NAMLIVNIIG SFGLGVTLGG LFGSVTETDP        60
     LPNLYFFLAT GFMAAFTTFS TFSTEAVGLI RTRKFYPACL YISVTLVASF LVFLAGMWLT       120
     V                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page