(data stored in ACNUC7421 zone)

EMBL: CP001791.PE492

CP001791.PE492       Location/Qualifiers
FT   CDS             complement(538195..540144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0508"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="KEGG: rhi:NGR_c26260 putative BCCT family
FT                   transporter; TIGRFAM: choline/carnitine/betaine
FT                   transporter; PFAM: BCCT transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98044"
FT                   /db_xref="GOA:D6XXI7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI7"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ADH98044.1"
FT                   /translation="MEKYSYETKNPNIVFYISAPIVLAFVLWGLFFPENLANVSSVALA
FT                   FTLDNFGWFYMLVTAFFIAFVLFLAISPFGKLKLGKPDEKPEFRFFSWLGMLFAAGIGV
FT                   GFVFWGVAEPILYYYDPHPDYIGQSDAVRAEAGLRYGVFHWALHPWAIFSLVALTLAYV
FT                   QFRKDQPALISSAFQPILGDRAYGGFGKAIDVLAVLATSTGVATTFGLSALQITGGLSY
FT                   LVDWIPNNATVNFIIIAIVTFLFIFSAATGVDKGIKILSTTNLILAGLLLFFVIIVGPT
FT                   LFIAQNFVSVLGNYMSNVVQMSFDLNPFGDGEWLGNNTIFFWAWHISWAPFMGIFIARI
FT                   SRGRTIREFVAGVLIVPSLLGALWFTTFGGTGLSLIMGGNDEIGDLVMNEVELALFATL
FT                   GELPISMITSVIAVILILIFFITSADSASYVLGAMTSQGSLSPKLTIKVIWGFLIAGTA
FT                   SVLLISGGLEGLQTASIVAALPFAMIMVVMVFSLLIMMTKDMKKDKIKTQRKQTKRVKD
FT                   EVYGGMKDEFYDEFREEAYDEMKEEVYGQMKEEVYDDFKDEVYDEFKDETYDRVKDEVY
FT                   EQMKEEAYEDFKGEAYDKVKEEVYEQVKDEVYDDIKEEVYEEFKEKIYEDLRDDLGEQL
FT                   NGELESPDDEKKDK"
     MEKYSYETKN PNIVFYISAP IVLAFVLWGL FFPENLANVS SVALAFTLDN FGWFYMLVTA        60
     FFIAFVLFLA ISPFGKLKLG KPDEKPEFRF FSWLGMLFAA GIGVGFVFWG VAEPILYYYD       120
     PHPDYIGQSD AVRAEAGLRY GVFHWALHPW AIFSLVALTL AYVQFRKDQP ALISSAFQPI       180
     LGDRAYGGFG KAIDVLAVLA TSTGVATTFG LSALQITGGL SYLVDWIPNN ATVNFIIIAI       240
     VTFLFIFSAA TGVDKGIKIL STTNLILAGL LLFFVIIVGP TLFIAQNFVS VLGNYMSNVV       300
     QMSFDLNPFG DGEWLGNNTI FFWAWHISWA PFMGIFIARI SRGRTIREFV AGVLIVPSLL       360
     GALWFTTFGG TGLSLIMGGN DEIGDLVMNE VELALFATLG ELPISMITSV IAVILILIFF       420
     ITSADSASYV LGAMTSQGSL SPKLTIKVIW GFLIAGTASV LLISGGLEGL QTASIVAALP       480
     FAMIMVVMVF SLLIMMTKDM KKDKIKTQRK QTKRVKDEVY GGMKDEFYDE FREEAYDEMK       540
     EEVYGQMKEE VYDDFKDEVY DEFKDETYDR VKDEVYEQMK EEAYEDFKGE AYDKVKEEVY       600
     EQVKDEVYDD IKEEVYEEFK EKIYEDLRDD LGEQLNGELE SPDDEKKDK                   649
//

If you have problems or comments...

PBIL Back to PBIL home page