(data stored in ACNUC7421 zone)

EMBL: CP001791.PE493

CP001791.PE493       Location/Qualifiers
FT   CDS             complement(540282..541139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98045"
FT                   /db_xref="GOA:D6XXI8"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98045.1"
FT                   /translation="MTDPINGTADTIPLIGQNHTYYSSKWQDHQKPSVYCGFNLAALLV
FT                   TPFWLAYRHLYDWLIFYVLLQSVFVAGASFLPWLFYAAGLGADLVSSQLLFILTGFTLL
FT                   HLGFGLKANALYYRRIQHLKNHGNASPLFYRSGASVKSGIITGLSALLFAVLVNVPLAN
FT                   WTYNPALEPGIYVFSDDNPVPEGVLDVRDEPDFVKYEARINLLFIHDEPIGDRSFRLLL
FT                   ERETDSGNGMAITRDRSFGIFSSSEVTLDLLDSEDPLTDTGTYHLTIFLDEEEIADTVF
FT                   SISL"
     MTDPINGTAD TIPLIGQNHT YYSSKWQDHQ KPSVYCGFNL AALLVTPFWL AYRHLYDWLI        60
     FYVLLQSVFV AGASFLPWLF YAAGLGADLV SSQLLFILTG FTLLHLGFGL KANALYYRRI       120
     QHLKNHGNAS PLFYRSGASV KSGIITGLSA LLFAVLVNVP LANWTYNPAL EPGIYVFSDD       180
     NPVPEGVLDV RDEPDFVKYE ARINLLFIHD EPIGDRSFRL LLERETDSGN GMAITRDRSF       240
     GIFSSSEVTL DLLDSEDPLT DTGTYHLTIF LDEEEIADTV FSISL                       285
//

If you have problems or comments...

PBIL Back to PBIL home page