(data stored in ACNUC7421 zone)

EMBL: CP001791.PE495

CP001791.PE495       Location/Qualifiers
FT   CDS             542035..544062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0511"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein; KEGG:
FT                   sme:SMa1548 diguanylate cyclase/phosphodiesterase; SMART:
FT                   EAL domain protein; GGDEF domain containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98047"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXX4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH98047.1"
FT                   /translation="MKHIDISTALNANPDHAAIISLEGEILLTNLSWQAFSRDNTGDPD
FT                   YTDVGVNYLDVLKKAGVTAVYEGIVSVLEGRQDFYHNKYPCHSPDENRWFIMTVTPLNE
FT                   GGDIQGALIVHRNITEVEWAKNQTVDILESMTDAFFAVDQNWRFTFLNQEAEKLLQVSR
FT                   SGLIGQNIWTVFPDALGTTIQFHYETVVDMKLAKQFETYFEPLDKWFEVHAYPRHQGGL
FT                   AVFFKDISEKKASEQQIWEMANLDELTGLANRRFIYEKMNGIIQKRIPFSLFFMDLNDF
FT                   KDINDVYGHDAGDQVLQKIGERLQALQEESGGVAARLGGDEFVFMIAELDHEVTGHFAE
FT                   RLLNLIRKRMSVSGYYAFSMVGSIGIAMYPETGMNVNEIMSAADAAMYEAKKSKSVTGT
FT                   YRFYEISMREVIKRRIVMGDDMLTAIDRGDFYYVYQPQINMKTGLVDGVEVLSRWKHPQ
FT                   LGMIPPPEFIELAEETGKIRPLTERTIRDVLKTVDGWRRDWGYDGRVAFNVSSSLIESP
FT                   SFFTFIKEQMTYFKIGRDQLELEITETVNLAASEALAYHLDQFRHIGVSLAIDDFGTGF
FT                   SKISHLSRLPVDRIKVDRTFINEIGSGSKGEAILYAVIDLMNQLEVDVVAEGVEEEEQV
FT                   RVLMGRNCSHIQGYYYARPTEEEEAVSYIWSFVQTKNSER"
     MKHIDISTAL NANPDHAAII SLEGEILLTN LSWQAFSRDN TGDPDYTDVG VNYLDVLKKA        60
     GVTAVYEGIV SVLEGRQDFY HNKYPCHSPD ENRWFIMTVT PLNEGGDIQG ALIVHRNITE       120
     VEWAKNQTVD ILESMTDAFF AVDQNWRFTF LNQEAEKLLQ VSRSGLIGQN IWTVFPDALG       180
     TTIQFHYETV VDMKLAKQFE TYFEPLDKWF EVHAYPRHQG GLAVFFKDIS EKKASEQQIW       240
     EMANLDELTG LANRRFIYEK MNGIIQKRIP FSLFFMDLND FKDINDVYGH DAGDQVLQKI       300
     GERLQALQEE SGGVAARLGG DEFVFMIAEL DHEVTGHFAE RLLNLIRKRM SVSGYYAFSM       360
     VGSIGIAMYP ETGMNVNEIM SAADAAMYEA KKSKSVTGTY RFYEISMREV IKRRIVMGDD       420
     MLTAIDRGDF YYVYQPQINM KTGLVDGVEV LSRWKHPQLG MIPPPEFIEL AEETGKIRPL       480
     TERTIRDVLK TVDGWRRDWG YDGRVAFNVS SSLIESPSFF TFIKEQMTYF KIGRDQLELE       540
     ITETVNLAAS EALAYHLDQF RHIGVSLAID DFGTGFSKIS HLSRLPVDRI KVDRTFINEI       600
     GSGSKGEAIL YAVIDLMNQL EVDVVAEGVE EEEQVRVLMG RNCSHIQGYY YARPTEEEEA       660
     VSYIWSFVQT KNSER                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page