(data stored in ACNUC7421 zone)

EMBL: CP001791.PE496

CP001791.PE496       Location/Qualifiers
FT   CDS             complement(544082..544645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0512"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: ppw:PputW619_3128 flavin reductase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98048"
FT                   /db_xref="GOA:D6XXX5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXX5"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADH98048.1"
FT                   /translation="MLEIKDNTILHCYPGLIAIVTVKDGDEVNMMAAGWHSFMSYAPPI
FT                   YGVAIAKERHTYQLVKNSQSFVINFVPAEHAHLIEGAGKISGRDNDKFNRLEARWSPGK
FT                   KTGSPVLDDAYVAYECTVKGMHEYGDHDWIAGDIVTFYQDSDRFEPETGFPDFHKLQLP
FT                   LFLGQSHYLIQDKTTTRKSIDINK"
     MLEIKDNTIL HCYPGLIAIV TVKDGDEVNM MAAGWHSFMS YAPPIYGVAI AKERHTYQLV        60
     KNSQSFVINF VPAEHAHLIE GAGKISGRDN DKFNRLEARW SPGKKTGSPV LDDAYVAYEC       120
     TVKGMHEYGD HDWIAGDIVT FYQDSDRFEP ETGFPDFHKL QLPLFLGQSH YLIQDKTTTR       180
     KSIDINK                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page