(data stored in ACNUC7421 zone)

EMBL: CP001791.PE497

CP001791.PE497       Location/Qualifiers
FT   CDS             complement(544797..545465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0513"
FT                   /product="Lipoprotein LpqB, GerMN domain protein"
FT                   /note="PFAM: Lipoprotein LpqB, GerMN domain; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98049"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXX6"
FT                   /inference="protein motif:PFAM:PF10646"
FT                   /protein_id="ADH98049.1"
FT                   /translation="MKKTKLTALALASVFFLAACGEGNDNEAVSGSAVDNGNDNADMNN
FT                   EPENVNNEADNEGNEEPEENNEENHNEEEANEEEDVAMIDQVTLYFSDDQLLETYRYVT
FT                   DESVTMDEDGAMDAFGLWLEGAPSEDLLLLAPEGTTVQSISFDDETAVISFSPELNDAN
FT                   LGSSGAMMLTEHIAMMFEQFGIAEVFVEIDGEQVENFLGHMSLEDPLRPGDPDEYPLYE
FT                   "
     MKKTKLTALA LASVFFLAAC GEGNDNEAVS GSAVDNGNDN ADMNNEPENV NNEADNEGNE        60
     EPEENNEENH NEEEANEEED VAMIDQVTLY FSDDQLLETY RYVTDESVTM DEDGAMDAFG       120
     LWLEGAPSED LLLLAPEGTT VQSISFDDET AVISFSPELN DANLGSSGAM MLTEHIAMMF       180
     EQFGIAEVFV EIDGEQVENF LGHMSLEDPL RPGDPDEYPL YE                          222
//

If you have problems or comments...

PBIL Back to PBIL home page