(data stored in ACNUC7421 zone)

EMBL: CP001791.PE5

CP001791.PE5         Location/Qualifiers
FT   CDS             5053..5343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97557"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D6XUZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97557.1"
FT                   /translation="MFIHLGGDHVLKTERIIAILDHQSQGLSKENVTFMEGYQGTMRTV
FT                   YVSEDQPKSMVVTEDEIFMSPISSHTLKRRAETNDASDELEDAIDVAEQKE"
     MFIHLGGDHV LKTERIIAIL DHQSQGLSKE NVTFMEGYQG TMRTVYVSED QPKSMVVTED        60
     EIFMSPISSH TLKRRAETND ASDELEDAID VAEQKE                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page