(data stored in ACNUC7421 zone)

EMBL: CP001791.PE504

CP001791.PE504       Location/Qualifiers
FT   CDS             551107..552657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0520"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="KEGG: geo:Geob_2608 delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98056"
FT                   /db_xref="GOA:D6XXY3"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY3"
FT                   /inference="protein motif:TFAM:TIGR01237"
FT                   /protein_id="ADH98056.1"
FT                   /translation="MVVPYRHEPFTDFTVEENRKDYQEALDYVKSQLGKEYPLIINGEK
FT                   VFTEKKSVSENPANHKEVVGYVSQCSQDLAKQAMEAADEAFTSWKKWDPAARANILFRA
FT                   SAMIRRRKHEFSAWLTYEAGKPWKEADADTAEAIDFLEYYARQILRLKDGIPINSRDGE
FT                   NNTFNYIPLGIGITISPWNFAFAIMAGTTVGPMVAGNTILLKPARTTPVIAYKFMEVLL
FT                   EAGLPKGVVNYVPGSSREIGDYLVDHPRTRFINFTGSKEVGLHIAERAAKVNEGQIWMK
FT                   RMISEMGGKDTIIVDSDADLELAAEAITYSAFGFSGQKCSACSRVIAHKDVYDDVLNRV
FT                   VERTKKLTVGPTFKDNSNFMGPVNDQDAFDKILDYIEVGKKEGRLMVGGTGDNSEGYFI
FT                   HPTVFADVDSKARVMQEEIFGPVVAFDKAEDFDELIEKANNTEYGLTGAVISNNRDHLE
FT                   QARQDFHVGNLYFNRGCTAAIVGYHPFGGFNMSGTDSKAGGPDYLLHFLQPKTVSDMF"
     MVVPYRHEPF TDFTVEENRK DYQEALDYVK SQLGKEYPLI INGEKVFTEK KSVSENPANH        60
     KEVVGYVSQC SQDLAKQAME AADEAFTSWK KWDPAARANI LFRASAMIRR RKHEFSAWLT       120
     YEAGKPWKEA DADTAEAIDF LEYYARQILR LKDGIPINSR DGENNTFNYI PLGIGITISP       180
     WNFAFAIMAG TTVGPMVAGN TILLKPARTT PVIAYKFMEV LLEAGLPKGV VNYVPGSSRE       240
     IGDYLVDHPR TRFINFTGSK EVGLHIAERA AKVNEGQIWM KRMISEMGGK DTIIVDSDAD       300
     LELAAEAITY SAFGFSGQKC SACSRVIAHK DVYDDVLNRV VERTKKLTVG PTFKDNSNFM       360
     GPVNDQDAFD KILDYIEVGK KEGRLMVGGT GDNSEGYFIH PTVFADVDSK ARVMQEEIFG       420
     PVVAFDKAED FDELIEKANN TEYGLTGAVI SNNRDHLEQA RQDFHVGNLY FNRGCTAAIV       480
     GYHPFGGFNM SGTDSKAGGP DYLLHFLQPK TVSDMF                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page